Torrents BluRay - Filmes, Séries e Desenhos Animados Torrent Dublados e Legendados Download BluRay

  • 2022-01-06Fecha de colección
  • 2022-02-15Actualizado
Torrents BluRay - Filmes, Séries e Desenhos Animados Torrent Dublados e Legendados Download BluRay
  • Dirección web:torrentsbluray.com
  • Servidor IP:199.59.243.226
  • Descripción del lugar:Torrents BluRay - Filmes, Séries e Desenhos Animados Torrent Dublados e Legendados com a Melhor Qualidade HD e Full HD de BluRay e Resoluções 720p, 1080, 2160p e 4K

nombre de dominio:torrentsbluray.comValuación

acerca de 1000~20000

nombre de dominio:torrentsbluray.comfluir

244

nombre de dominio:torrentsbluray.comBueno o malo

Gran espectáculo. Puede tener éxito Ji una prosperidad y una decadencia. trabajo en vano

sitio web:Torrents BluRay - Filmes, Séries e Desenhos Animados Torrent Dublados e Legendados Download BluRayPesos

2

sitio web:Torrents BluRay - Filmes, Séries e Desenhos Animados Torrent Dublados e Legendados Download BluRayIP

199.59.243.226

sitio web:Torrents BluRay - Filmes, Séries e Desenhos Animados Torrent Dublados e Legendados Download BluRaycontenido

Thedomainnametorrentsbluray.comisforsalewindow.locale="en-us"functionsetI18nLocale(){if(typeof(window)==="undefined"){return;}if(typeof(window.I18n)==="undefined"){return;}window.I18n.defaultLocale="en-us"window.I18n.locale="en-us"window.I18n.delimiter=","window.I18n.format="%u%n"}if(document.addEventListener)document.addEventListener('DOMContentLoaded',setI18nLocale)BuyerProtectionProgramWhenyoubuyadomainnameatDan.com,you’reautomaticallycoveredbyouruniqueBuyerProtectionProgram.ReadmoreabouthowwekeepyousafeonourTrustandSecuritype.Nexttooursecuredomainownershiptransferprocess,westrictlymonitoralltransactions.Ifanythinglooksweird,wetakeimmediateaction.Andifthesellerdoesn39;tdeliverontheirpartofthedeal,werefundyouwithin24hours.Fast&easytransfers98%ofalldomainownershiptransfersarecompletedwithin24hours.Thesellerfirstdeliversthedomaintous,thenwesendyouyourtailoredtransferinstructions.Needhelp?Ourdomainownershiptransferspecialistswillassistyouatnoadditionalcost.HasslefreepaymentsPaybybankwireandgeta1%discountoruseoneofthemostpopularpaymentoptionsailablethroughourpaymentprocessor,Adyen.AdyenisthepaymentplatformofchoiceformanyleadingtechcompanieslikeUber&eBay.VAToverview)ValueAddedTaxTheValueAddedTax(VAT)isaconsumptiontaxappliedintheEuropeanUnion(EU)toallgoodsandservices.WhohastopayVAT?AllconsumersintheEUarechargedVATonthepurchaseofgoodsandservices.BusinessesintheEUbuyingfromabusinessinthesamecountryarealsochargedVAT.BusinessesintheEUbuyingfromabusinessinadifferentEUcountryarenotchargedVAT.ConsumersandbusinessesoutsideoftheEuropeanUnionarenotchargedVAT.VATexampleTheVATrateprovidedonthispeisonlyanexample.Itwillbecalculatedaccordinglyduringthecheckoutprocessafterenteringyourbillingdetails.VATcalculationexampleWhatdoIpay?CostsinUSDPriceexcl.VATUSD$1,00021%VATUSD$210TotalPriceUSD$1,210EstimateinUSD)ConversionThisamountisanestimatebasedonthemostrecentcurrencyconversionrate.PricingestimateinUSDWhatdoIpay?CostsinUSDPriceexcl.VATUSD$4950%VATUSD$0TotalPriceUSD$495LeasetoownconditionsUSD$99MonthlyPaymentMonths))PriceoverviewFullownershipafter5monthsLongtermservicefee0%Totalpurchaseprice495)UsethedomainshortlyafterpaymentAfterthefirstpayment,oursystemautomaticallytransfersthedomaintoourownholdingregistrartokeepitsafeandailableforyou.Oncethetransferisdone(thiscanvaryperdomainsincesomeregistrarsapprovetransfersonlyafter5days)youcanmanetheDNSofthedomainviayourBuyerControlPanel.)DomaintransferafterthefinalinstallmentispaidWhenthefinalinstallmentispaidfor,wewillassistyouwithTorrents BluRay - Filmes, Séries e Desenhos Animados Torrent Dublados e Legendados Download BluRaytransferringthedomaintoaregistrarofyourchoiceandchangingtheownershiprecordsofthedomain.)StopatanytimeYoucancancelaninstallmenttransactionwheneveryouwant.Thisisonlyailableforbuyers.Sellerscan’tcancelthecontract,aslongasyoudonotmissanyfinalmonthlypaymentdeadline(s).Whenyouopttocancelatransaction,thereceivedinstallmentswillbekeptbytheseller.Youwon’treceivetheownershipofthedomainandthedomainwillbereturnedtotheoriginalseller.)LongtermservicefeeLongtermservicefeeisafeepercenteaddedwhenyoupickaperiodlongerthan1year.ThefeeisincludedinthepriceyouseeintheLeasetoowndialog.PricingexampleofLeasetoownmodelsDomainpriceInstallmentsServicefee$1,0001-12months$0(0%)$1,00013-24months$100(10%)$1,00025-36months$200(20%)$1,00037-60months$300(30%)Whatdoestheservicefeecostcover?Theservicefeecoversthetransfer&renewalexpensesofthedomain,hostingDNS,providingsupportforyears,andtherecurringmonthlypaymentprocessingexpensesthatDan.commakestofacilitatethistypeoftransaction.Readmore)EstimateinUSD)ConversionThisamountisanestimatebasedonthemostrecentcurrencyconversionrate.PricingestimateofLeasetoOwnmodelinUSDWhatdoIpaymonthly?CostsinUSDMonthlyPriceexcl.VAT&servicefee$Monthlyservicefee,excl.VAT$0%VAT$MonthlyTotalPrice$)Thedomainnametorrentsbluray.comisforsale!DSListedbyDomainsellerGetthisdomainPaythefullUSD$495now,orselectLeasetoownBuynowUSD$495LeasetoownUSD$99/monthPickthepricethatmatchesyourbudget.USD$99MonthlyPaymentMonths))Fullownershipafter5monthsMoreinformationNext))FreeOwnershiptransfer)FreeTransactionsupport)SecurepaymentsDSListedbyDomainsellerBuyerProtectionprogramFast&easytransfersHasslefreepaymentsThesimple,safewaytobuydomainnamesNomatterwhatkindofdomainyouwanttobuyorlease,wemakethetransfersimpleandsafe.Here’showitworks)Privacypolicy·Donotsellmypersonalinformation·Manecookies·Termsofuse·Disclaimer·Sitemap·©2024Dan.comanUndevelopedBVsubsidiary.AllRightsReserved.EnglishNederlandsEspañolहिंदीDeutschFrançais中文$495or$99/monthBuywindow.sendGA("send","event","DomainNegotiation","00-ParkingPe-Viewed","",0,{nonInteraction:true})$(document).ready(function(){varauth_token=$('meta[name=csrf-token]').attr('content');setTimeout(function(){$.post('/domain_views',{domain_name:'torrentsbluray.com',authenticity_token:auth_token,});},300);});I18n.translations['en-us']=I18n.extend((I18n.translations['en-us']||{}),{"public":{"label":{"buy_now":"Buy","make_offer":"Makeoffer","rent":"Rent","month":"month","now":"now","buy_or_mothly":"or","request_price":"Pricerequest"}}});I18n.translations['en-us']=I18n.extend((I18n.translations['en-us']||{}),{"errors":{"messes":{"not_deliverable":"Youremaildoesnotseemtobecorrect.Pleasesubmitacorrectone","custom_confirmation":"don'tmatch","minimum_bid":"Yourofferdoesnotmeettheminimumstartingofferrequirementsetbytheseller.","maximum_bid":"Youcannotplaceanofferhigherthanthebuynowpriceofthedomain.","phone":"Pleaseenteravalidphonenumber","please_add_an_ime":"missing.Pleaseaddanimebeforesing","ime_is_required":"Imeismissing.Pleaseaddanimebeforesing","ime_is_invalid":"Imeisinvalid","ime_is_too_big":"Imecanbe%{size}mbmaximum","whole_number":"Pleaseenternumbersonly","tld_not_allowed":"TLD%{tld}isnotallowedfordistributionnetwork","password_format":"Passwordmustincludeatleastoneuppercaseandlowercaseletter,onenumeric,andonespecialcharacter","otp_invalid_with_backup_code":"Invalidverificationcode,pleasetryainorenterabackupcode.","otp_invalid":"Theverificationcodeenteredisinvalid.Tryain.","otp_expired":"Theverificationcodeisexpired,pleasetrytoresendthecode.","code_already_sent":"Codewasalreadysent,pleasewait%{time}beforetryingain.","already_confirmed":"wasalreadyconfirmed,pleasetrysigningin","confirmation_period_expired":"needstobeconfirmedwithin%{period},pleaserequestanewone","expired":"hasexpired,pleaserequestanewone","not_found":"notfound","not_locked":"wasnotlocked","not_sed":{"one":"1errorprohibitedthis%{resource}frombeingsed:","other":"%{count}errorsprohibitedthis%{resource}frombeingsed:"},"accepted":"mustbeaccepted","blank":"can'tbeblank","present":"mustbeblank","confirmation":"doesn'tmatch%{attribute}","empty":"can'tbeempty","equal_to":"mustbeequalto%{count}","even":"mustbeeven","exclusion":"isreserved","greater_than":"mustbegreaterthan%{count}","greater_than_or_equal_to":"mustbegreaterthanorequalto%{count}","inclusion":"isnotincludedinthelist","invalid":"isinvalid","less_than":"mustbelessthan%{count}","less_than_or_equal_to":"mustbelessthanorequalto%{count}","not_a_number":"isnotanumber","not_an_integer":"mustbeaninteger","odd":"mustbeodd","record_invalid":"Validationfailed:%{errors}","restrict_dependent_destroy":{"one":"Cannotdeleterecordbecauseadependent%{record}exists","many":"Cannotdeleterecordbecausedependent%{record}exist"},"taken":"hasalreadybeentaken","too_long":{"one":"istoolong(maximumis1character)","other":"istoolong(maximumis%{count}characters)"},"too_short":{"one":"istooshort(minimumis1character)","other":"istooshort(minimumis%{count}characters)"},"wrong_length":{"one":"isthewronglength(shouldbe1character)","other":"isthewronglength(shouldbe%{count}characters)"},"other_than":"mustbeotherthan%{count}"}}});I18n.translations['en-us']=I18n.extend((I18n.translations['en-us']||{}),{"validation":{"attributes":{"checkout_link":{"price":{"lease_to_own":{"invalid":"toolowforaLTOorder.Minimumpriceis%{value}."}}},"number_of_installments":{"invalid":"Numberofinstallmentsforthispricemustbebetween%{min}and%{max}"},"default_starting_offer":{"lower_than_buy_now":"mustbelessthanorequaltothelowestbuynowpriceofallyourdomains(%{price})","lower_than_minimum_offer":"mustbelessthanorequaltothelowestminimumofferpriceofallyourdomains(%{price})"},"display_name":{"not_consistent_with_name":"mustbeconsistentwithdomainname"},"domain":{"does_not_belong_to_user":"isnotlisted","does_not_exist":"doesnotexist","is_already_sold":"isalreadysold","is_already_rented":"isalreadyrented","in_excluded_list":"Pleasedon’ttrytoadddomainsyoudon'town","limit_imported":"Youhealreadyimportedamaximumof3leadsforthisdomaintoday.Tryaintomorrow.","listing_on_hold":"ItisnotpossibletoeditthisdomainasitiscurrentlyonholdonAfternic,pleasetrylaterain."},"domain_category":{"invalid_name":"Acategorywiththisnamealreadyexists"},"conversation":{"company_name_should_be_empty":"companynameshouldbeemptywhennotabusiness","transaction_state_is_locked":"transactionstateislockedandcannotbechanged"},"import_source":{"not_allowed":"Thisimportsourceisnotallowedforthisuser"},"max_dimensions":{"height":"Heightcanbeatmost%{height}pixels","width":"Widthcanbeatmost%{width}pixels"},"min_dimensions":{"height":"Heightshouldbeatleast%{height}pixels","width":"Widthshouldbeatleast%{width}pixels"},"rent_fee":{"no_decimals":"shouldn'tincludedecimals"},"zipcode":{"blank":"isblank"},"dns_record":{"invalid_name":"Thenameyouheprovidedisinvalid.Pleaseenteravalidnameorenter\"@\"toresolveatroot","invalid_ipv4":"TheIPv4addressyouheprovidedisinvalid","invalid_ipv6":"TheIPv6addressyouheprovidedisinvalid","invalid_cname":"TheCNAMEtargetyouheprovidedisinvalid","invalid_mx":"TheMXmailserveryouheprovidedisinvalid","invalid_priority":"TheMXpriorityhastobebetween0-","invalid_txt":"TheTXTrecordcontentyouheprovidedisinvalid"},"payout_method":{"same_as_higher_payout_method":"Whenoverwritepayoutisactiveitmustbedifferentthanthepreferredpayoutmethod"}}}});I18n.translations['en-us']=I18n.extend((I18n.translations['en-us']||{}),{"public":{"locale_banner":{"title":"Doyouwishtotranslatethispeto%{langue}?","translate_btn":"Translate","dismiss_btn":"Dismiss"}}});I18n.translations['en-us']=I18n.extend((I18n.translations['en-us']||{}),{"public":{"cookie_mane":{"dont_sell_personal_info":"Donotsellmypersonalinformation","we_use_cookie":"Weusecookies","cookie_description_head":"Byclicking‘acceptallcookies’,youreetoouruseofthesetoolsforadvertising,analyticsandsupport,andconsenttoour","cookie_description_body":"Ourwebsiteusescookiesandsimilartechnologies,toenableessentialservicesandfunctionalityonoursiteandtocollectdataonhowvisitorsinteractwithoursite,products,andservices.","use_cookie_description":"Ourwebsiteusescookiesandsimilartechnologies,toenableessentialservicesandfunctionalityonoursiteandtocollectdataonhowvisitorsinteractwithoursite,products,andservices.Byclicking‘acceptallcookies’,youreetoouruseofthesetoolsforadvertising,analyticsandsupport,andconsenttoour","essential_only":"Essentialonly","accept_all_cookies":"Acceptallcookies","accept_all":"Acceptall","cookie_privacy_links":"\u003catarget='_blank'href='%{cookie_url}'\u003eCookiePolicy\u003c/a\u003e\u003cspan\u003eand\u003c/span\u003e\u003catarget='_blank'href='%{privacy_url}'\u003ePrivacyPolicy\u003c/a\u003e","mane_cookies":"Manecookies","support_warning":"Tousechatsupportservices,turnonyoursupportcookies","essential_tooltip":"Essentialcookiesarealwayson","categories":{"essential_cookies":{"title":"Essentialcookies","description":"Enablesessentialservicesandfunctionality,includingidentityverification,servicecontinuityandsitesecurity.Opt-Outisnotailable."},"performance_cookies":{"title":"Performancecookies","description":"Collectsanonymousdataabouthowvisitorsuseoursiteandhowitperforms.Weusethistoimproveourproducts,servicesanduserexperience."},"advertising_cookies":{"title":"Advertisingcookies","description":"Allowustoserveadvertisingrelevanttoyouonourplatformandother3rdpartyplatforms."},"support_cookies":{"title":"Supportcookies","description":"Powersinteractiveservicessuchaschatsupportandcustomerfeedbacktools."}},"modal":{"title":"Maneyourcookies","text":"Youcanturnofftheothercookieoptions.","close_btn":"Closewindow","apply_btn":"Acceptselectedcookies"}}}});I18n.translations['en-us']=I18n.extTorrents BluRay - Filmes, Séries e Desenhos Animados Torrent Dublados e Legendados Download BluRayend((I18n.translations['en-us']||{}),{"action":{"publish_sales":"Publishsales","keep_sales_private":"Keepsalesprivate","add":"Add","sed":"Sed","add_domains":"Adddomains","add_lead":"Addnewlead","add_list":"Addlist","add_more":"Addmore","add_one":"Addone","add_to_list":"Addtolist","apply_now":"Applynow","archive":"Archive","back_home":"Gotohomepe","buy_now":"Buynowfor%{price}","cancel":"Cancel","checkout":"Checkout","checkout_next_rent_period":"Checkoutnextrentperiod","cancel_brokere":"Cancelbrokere","close":"Close","close_popup":"Closethispopup","confirm":"Confirm","continue":"Continue","delete":"Delete","delete_forever":"Deleteforever","disable":"Disable","edit":"EditTorrents BluRay - Filmes, Séries e Desenhos Animados Torrent Dublados e Legendados Download BluRay","enable":"Enable","export_to_csv":"ExporttoCSV","filters":"Filters","impersonate":"Impersonate","import_domains":"Importdomains","import_lead":"Importyourlead","issue_payment":"Issuepayment","learn_more":"Learnmore","load_more":"Loadmore","load_more_loading":"Loading","mark_as_paid":"Markaspaid","preview":"Preview","print":"Print","publish":"Publish","push_domain":"Pushdomain","read_less":"Readless","read_more":"Readmore","reset_filters":"Resetfilters","restore":"Restore","se":"Se","search":"Search","see_domains":"Seedomains","see_email":"Seeemail","see_profile":"Seeprofile","send_messe":"Sendyourmesse","share":"VisitmydomainshoppoweredbyDan.com:","show_more":"Showmemore","show":{"show_more":"Showmore","show_less":"Showless"},"sort_by":"Sortby","results":"Results","submit_offer":"Submitoffer","buying_option":"Buyingoption","skip_step":"Skipthisstep","switch_off":"Donotreceive","switch_on":"ReceiveOn","toggle":"Toggle","transfer_domain":"Transferdomain","kyc_approve":"Approve(KYC)","reset_2fa":"Disable2FA","reset_2fa_proceed":"Proceed","2fa_disabled":"2FAisdisabled","kyc_disapprove":"Disapprove(Kyc)","afternic_ban":"MarkbannedonAfternic","afternic_unban":"UnmarkbannedonAfternic","add_domain_to_blocklist":"Adddomaintotheblocklist","remove_domain_from_blocklist":"Removedomainfromtheblocklist","confirm_reset_2fa":"Areyousureyouwanttodisablethe2FAofthisseller?","restore_account":"Restoreaccount","update_cashparking":"Re-pushdomainstoCashparking","remove_cashparking":"RemovedomainsfromCashparking","destroy_payoneer_account":"DeleteSeller'sPayoneeraccount","mark_as_unpaid":"MarkasUnpaid","installment_returned":"Installmentmarkedasunpaid.","rentals":{"mark_as_paid":{"success":"Rentalmarkedaspaid.Revenuebeingprocessed.","failure":"UnabletomarkRentalaspaid."}}}});

Sitio:Torrents BluRay - Filmes, Séries e Desenhos Animados Torrent Dublados e Legendados Download BluRayReporte

Si hay una infracción del sitio, haga clic en InformarReporte

Información recomendada

Sitio recomendado